Metabolic & Weight Management

Adiponectin

Last updated 12 August 2026

Evidence on file6 human observational studies · 5 citations not yet graded

Strongest sourceDivergent responses of adiponectin and leptin to exercise in women with overweight or obesity: a systematic r… (human observational study)

Dosing on file unverified

PEG-BHD1028: SAD 4-64 µg/kg, MAD 8-32 µg/kg QD for 28 days

Carried from a source that labels it unverified, and reproduced with that label attached. A record of what is reported, not a recommendation. No citation on this page establishes it.

Literature on file 11

human observational
Divergent responses of adiponectin and leptin to exercise in women with overweight or obesity: a systematic review and meta-regression. graded on: a synthesis of human studies — “systematic review”
human observational
NCT02335996: Impact Hypercortisolism on Adipose Epicardial and on Myocardial Function graded on: a registered clinical study — “clinicaltrials.gov”
human observational
NCT03505541: Effect of Adiponectin and TNFa on Uterine Contractility in GDM and Obese Pregnant Patients graded on: a registered clinical study — “clinicaltrials.gov”
human observational
NCT02449408: Novel Screening Tools For the Evaluation and Management of Malnourished Children in the Developing World graded on: a registered clinical study — “clinicaltrials.gov”
human observational
NCT02682004: Serotonin, Leptin and Adiponectin Level in Patients With Postpartum Depression: Controlled Study graded on: a registered clinical study — “clinicaltrials.gov”
human observational
NCT03170245: Adiponectin, Interleukin-6 (IL-6) and High Sensitive C-reactive Protein (hsC-RP) in Relation to Carotid Intima-media Thickness in B-thalassemia Patients graded on: a registered clinical study — “clinicaltrials.gov”

Not graded

5 citations whose study design could not be read from the title. Left ungraded rather than guessed at.

Identity

Sequence: ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Notes unverified prose

Phase 1; (PEG)-BHD1028 Phase 1 (adiponectin agonist)

Not on file 7

7 of the 8 fields we track hold nothing on this record, and each says why. A blank field is a bug; a named absence is a finding.

molecular weightnothing we hold supplies it
molecular formulanothing we hold supplies it
CAS registry numbernothing we hold supplies it
PubChem identifiernothing we hold supplies it
SMILES stringnothing we hold supplies it
InChInothing we hold supplies it
InChI keynothing we hold supplies it

Each field links to every other record missing the same thing. The full ledger holds 521 gaps across 136 records.