IGF-1

Literature on file 8

• human observational
  Serum insulin-like growth factor-1 concentrations are not reduced in Pomeranian dogs with Alopecia X: a case-control study. graded on: an observational human design — “case-control”
• human observational
  NCT00673309: Assessment of Mechanisms of Improved Wound Healing of Anabolic Agents and Diet in Severely Burned Patients graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT01207908: IGF-1 Therapy and Muscle Function in Duchenne Muscular Dystrophy graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT01525901: A Double-Blind Placebo-Controlled Crossover Trial of Insulin-Like Growth Factor-1 (IGF-1) in Children and Adolescents With 22q13 Deletion Syndrome(Phelan-McDermid Syndrome) graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT00330668: Recombinant Human Insulin-Like Growth Factor-1 (IGF-1) Treatment of Children With Growth Failure Associated With Primary IGF-1 Deficiency: An Open-Label, Multi-Center, Extension Study graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT00684957: Differential Effects of rhGH vs. rhIGF-1 on Cardiovascular Risk Factors in Adult Patients With Growth Hormone Deficiency graded on: a registered clinical study — “clinicaltrials.gov”

Not graded

2 citations whose study design could not be read from the title. Left ungraded rather than guessed at.

• not graded
  Marked and reversible circulating insulin-like growth factor-1 elevation during teprotumumab N01 treatment for thyroid eye disease with limited correspondence to glycemic changes.
• not graded
  Pharmacogenetic hypersensitivity to somatropin in a child with severe growth hormone deficiency and MC4R p.V166I variant.

Identity

UniProt

P01343

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA