Tesamorelin: dosing, evidence and sources

Mechanism

Stimulates pituitary GH release, IGF-1 elevation, and lipolysis.

Regulatory status

Approved by the FDA. Marketed as EGRIFTA WR, EGRIFTA SV. Earliest approval 2010-11-10. Application BLA022505.

An approval grades as rung 1 on this site, because 21 CFR 314.126 requires adequate and well-controlled human investigations and one cannot be granted without them. It covers specific indications and doses, though, and does not transfer to other uses of the same molecule.

Reported effects

What sources associate with this compound. Reported categories, not outcomes we have graded — each would need its own citation and rung.

Visceral fat reduction
Body composition
Recovery support

Dosing on file unverified

1-2 mg daily, cycled 12–16 weeks

Reported dose	Volume	Draw
Low — 1 mg	0.2 mL	20 units
High — 2 mg	0.4 mL	40 units

What that assumes. Assumes 10 mg in 2 mL (5000 mcg/mL) drawn on a U-100 barrel — the preset on this record, not a recommendation and not the only way to mix it. Change the vial mass, the diluent or the barrel and every number in this table changes. Run your own.

Carried from a source that labels it unverified, and reproduced with that label attached. A record of what is reported, not a recommendation. No citation on this page establishes it.

Reconstitution

Vial	Diluent	Concentration	Typical dose	Draw
10 mg	2 mL	5000 mcg/mL	1000 mcg	20 units

mass ÷ diluent = concentration; dose ÷ concentration = volume; volume × the syringe factor = units on the barrel (100 for U-100, 40 for U-40). Run your own numbers.

Reported adverse effects

Injection site erythema and pruritus

Common (1-10%)onset: Immediatereported reversible
Arthralgia

Common (1-10%)onset: Weeksreported reversible
Peripheral edema

Common (1-10%)onset: Weeksreported reversible
Reduced glucose tolerance

Documented in trialsonset: Ongoingreported reversible

Literature on file 3

human RCT
FDA approval BLA022505 graded on: an FDA approval (BLA022505), which requires adequate and well-controlled human investigations — “BLA022505”

Not graded

2 citations whose study design could not be read from the title. Left ungraded rather than guessed at.

Identity

Space-filling 3D model of Tesamorelin, carbon grey, nitrogen blue, oxygen red — Built from the SMILES on this record — the atoms, bonds and stereochemistry are exact. The shape is **one computed low-energy pose**, not a measured structure: a flexible peptide in solution has no single conformation. The skeletal formula below claims connectivity and nothing more, which is what we actually know.

2D chemical structure of Tesamorelin — Built from the SMILES on this record — the atoms, bonds and stereochemistry are exact. The shape is **one computed low-energy pose**, not a measured structure: a flexible peptide in solution has no single conformation. The skeletal formula below claims connectivity and nothing more, which is what we actually know.

Molecular weight: 5136
Molecular formula: C221H366N72O67S
CAS number: 218949-48-5
PubChem CID: 16137828
InChI key: QBEPNUQJQWDYKU-BMGKTWPMSA-N
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
SMILES: CC/C=C/CC(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N
InChI: InChI=1S/C221H366N72O67S/c1-25-28-30-53-163(308)260-145(92-120-54-58-122(299)59-55-120)198(343)255-116(21)179(324)276-150(96-169(316)317)199(344)256-117(22)180(325)291-172(111(16)26-2)214(359)284-147(91-119-43-31-29-32-44-119)206(351)293-174(118(23)298)215(360)285-149(95-162(230)307)205(350)289-155(104-297)210(355)280-146(93-121-56-60-123(300)61-57-121)203(348)267-130(51-41-83-248-220(240)241)186(331)266-126(46-34-36-78-223)197(342)290-171(110(14)15)212(357)283-141(87-106(6)7)183(328)252-100-166(311)258-133(63-70-157(225)302)190(335)278-144(90-109(12)13)202(347)288-152(101-294)208(353)257-115(20)178(323)262-128(49-39-81-246-218(236)237)185(330)265-125(45-33-35-77-222)189(334)277-143(89-108(10)11)201(346)279-142(88-107(8)9)200(345)272-137(66-73-160(228)305)195(340)282-151(97-170(318)319)207(352)292-173(112(17)27-3)213(358)274-139(76-85-361-24)196(341)287-153(102-295)209(354)268-131(52-42-84-249-221(242)243)187(332)270-135(64-71-158(226)303)192(337)269-132(62-69-156(224)301)182(327)251-99-165(310)259-134(67-74-167(312)313)191(336)286-154(103-296)211(356)281-148(94-161(229)306)204(349)273-136(65-72-159(227)304)193(338)271-138(68-75-168(314)315)194(339)264-124(47-37-79-244-216(232)233)181(326)250-98-164(309)253-113(18)176(321)261-127(48-38-80-245-217(234)235)184(329)254-114(19)177(322)263-129(50-40-82-247-219(238)239)188(333)275-140(175(231)320)86-105(4)5/h28-32,43-44,54-61,105-118,124-155,171-174,294-300H,25-27,33-42,45-53,62-104,222-223H2,1-24H3,(H2,224,301)(H2,225,302)(H2,226,303)(H2,227,304)(H2,228,305)(H2,229,306)(H2,230,307)(H2,231,320)(H,250,326)(H,251,327)(H,252,328)(H,253,309)(H,254,329)(H,255,343)(H,256,344)(H,257,353)(H,258,311)(H,259,310)(H,260,308)(H,261,321)(H,262,323)(H,263,322)(H,264,339)(H,265,330)(H,266,331)(H,267,348)(H,268,354)(H,269,337)(H,270,332)(H,271,338)(H,272,345)(H,273,349)(H,274,358)(H,275,333)(H,276,324)(H,277,334)(H,278,335)(H,279,346)(H,280,355)(H,281,356)(H,282,340)(H,283,357)(H,284,359)(H,285,360)(H,286,336)(H,287,341)(H,288,347)(H,289,350)(H,290,342)(H,291,325)(H,292,352)(H,293,351)(H,312,313)(H,314,315)(H,316,317)(H,318,319)(H4,232,233,244)(H4,234,235,245)(H4,236,237,246)(H4,238,239,247)(H4,240,241,248)(H4,242,243,249)/b30-28+/t111-,112-,113-,114-,115-,116-,117-,118+,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,171-,172-,173-,174-/m0/s1

Classified as

Lipolysis Stimulationmechanism: This mechanism is the source of the most common category error on the site. A record can be well supported for lipolysis and carry nothing at all for fat loss, and the two live in different fields with different rungs on the ladder at /evidence/rubric.
Growth Hormone / IGF-1 Axispathway: The lab value people actually track, IGF-1 in ng/mL, sits two steps downstream of where most of these compounds act, so a record's mechanism and its measurable marker are rarely the same thing.
Subcutaneousroute: This is the route the reconstitution arithmetic assumes. Mass divided by diluent volume gives concentration, dose divided by concentration gives volume, and volume in mL multiplied by 100 gives units on a U-100 barrel: 5 mg in 2 mL is 2.5 mg/mL, and 0.25 mg comes out at 0.1 mL, which is 10 units.

Also called

Tesamorelin

Notes unverified prose

FDA-approved (HIV); FDA-approved (Egrifta)

Not on file 0

All 8 tracked fields hold a value on this record: molecular weight and formula, CAS number, PubChem CID, amino-acid sequence, SMILES, InChI and InChI key.

Counted from the record itself, not from what a source said it was missing. 136 of 185 records still have at least one empty.

Listed prices 33

What 33 shops we track listed for Tesamorelin, read from their own public catalogues on 2026-08-12. We take no commission on these and they are not ranked by any payment — how vendors are scored.

Listed in USD
Vendor	Size	Price	Per mg
Peptide Crafters	10 mg	$60.00 USD ~~$65.00 USD~~	$6.00/mg
Paramount Peptides	10 mg	$64.60 USD	$6.46/mg
Zenith Biopeptides	10 mg	$65.00 USD	$6.50/mg
SimplePeptide	10 mg	$75.00 USD	$7.50/mg
Biotech Peptides	5 mg	$38.00 USD	$7.60/mg
Core Peptides	5 mg	$43.00 USD	$8.60/mg
Certified Peptides	10 mg	$89.00 USD	$8.90/mg
AminoVault	10 mg	$89.25 USD ~~$105.00 USD~~	$8.93/mg
Ascension Peptides	5 mg	$50.00 USD ~~$89.99 USD~~	$10.00/mg
Peptide Partners	10 mg	$122.00 USD	$12.20/mg
Raw Amino	5 mg	$69.00 USD	$13.80/mg
Swiss Chems ships worldwide	2 mg	$27.95 USD	$13.97/mg
BioLongevity Labs	10 mg	$149.97 USD	$15.00/mg
Soma Chems	size not listed	$49.99 USD	—
Coastal Peptides	size not listed	$65.00 USD ~~$70.00 USD~~	—
Xcel Peptides ships worldwide	size not listed	$79.00 USD ~~$122.00 USD~~	—
Eternal Peptides	size not listed	$84.99 USD ~~$100.00 USD~~	—
Protide Health	size not listed	$85.00 USD	—
Luxara Labs	size not listed	$90.00 USD ~~$112.50 USD~~	—
Apex Peptides	size not listed	$118.00 USD	—

Listed in CAD
Vendor	Size	Price	Per mg
The Peptide Labs	10 mg	$85.00 CAD	$8.50/mg
Nox Peptides	10 mg	$89.99 CAD	$9.00/mg
Northern Peptides	10 mg	$90.00 CAD	$9.00/mg
PeptideProCanada	10 mg	$95.00 CAD ~~$125.00 CAD~~	$9.50/mg
BioPerform	10 mg	$99.99 CAD	$10.00/mg
Core Peptides Canada	5 mg	$53.02 CAD	$10.60/mg
Black Helix Labs	10 mg	$110.00 CAD ~~$130.00 CAD~~	$11.00/mg
Pacific Peptides	10 mg	$125.00 CAD	$12.50/mg
Panda Peptide	5 mg	$64.99 CAD	$13.00/mg
Maple Research Labs	5 mg	$99.00 CAD	$19.80/mg
Peptide Shop Canada	size not listed	$35.00 CAD	—
Canada Peptide	size not listed	$55.99 CAD ~~$75.99 CAD~~	—
Peptide Supply Online	size not listed	$85.00 CAD	—

Prices are the vendor's own listing, reproduced with the date we read it — never converted between currencies, and compared per milligram only where the vendor states the vial size.